MYDGF_MOUSE Q9CPT4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CPT4
Recommended name：Myeloid-derived growth factor
EC number：
Alternative names：(MYDGF)
Cleaved into：
GeneID：28106
Gene names (primary )：Mydgf
Gene names (synonym )：D17Wsu104e
Gene names (ORF )：
Length：166
Mass：17982
Sequence：MAAPSGGFWTAVVLAAAALKLAAAVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Tissue specificity：Expressed in prostate, spleen and lung, and weakly expressed in the left ventricle (LF) and liver. Expressed predominantly in inflammatory cells, such as monocytes and macrophages, and weakly expressed in neutrophils, T-cells, B-cells, endothelial cells and cardiac myocytes, after myocardial infarction (MI) (at protein level). {ECO:0000269|PubMed:25581518}.
Induction：Up-regulated by ischemia/hypoxia and reperfusion (IR) injury in the left ventricle (at protein level) (PubMed:25581518). Up-regulated during adipocyte differentiation (at protein level) (PubMed:15378209). {ECO:0000269|PubMed:15378209, ECO:0000269|PubMed:25581518}.
Developmental stage：
Protein families：MYDGF family