MMGT1_MOUSE Q8K273
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K273
Recommended name：Membrane magnesium transporter 1
EC number：
Alternative names：(ER membrane protein complex subunit 5) (Transmembrane protein 32)
Cleaved into：
GeneID：236792
Gene names (primary )：Mmgt1
Gene names (synonym )：Emc5 Tmem32
Gene names (ORF )：
Length：131
Mass：14677
Sequence：MAPSLWKGLVGVGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDATNSSNLDALSSNTSLKLRKFDSLRR
Tissue specificity：Abundant in heart muscle and kidney with lower levels in liver and brain and very little expression in intestine or colon. In kidney, highest levels in distal convoluted tubule. {ECO:0000269|PubMed:18057121}.
Induction：Up-regulated by low extracellular Mg(2+). {ECO:0000269|PubMed:18057121}.
Developmental stage：
Protein families：Membrane magnesium transporter (TC 1.A.67) family