RHOC_MOUSE Q62159
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62159
Recommended name：Rho-related GTP-binding protein RhoC
EC number：
Alternative names：(Silica-induced gene 61 protein) (SIG-61)
Cleaved into：
GeneID：11853
Gene names (primary )：Rhoc
Gene names (synonym )：Arhc
Gene names (ORF )：
Length：193
Mass：22006
Sequence：MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Tissue specificity：
Induction：Up-regulated in silica-treated macrophages. {ECO:0000269|PubMed:7868905}.
Developmental stage：
Protein families：Small GTPase superfamily, Rho family