ABHD6_MOUSE Q8R2Y0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2Y0
Recommended name：Monoacylglycerol lipase ABHD6
EC number：EC 3.1.1.23
Alternative names：(2-arachidonoylglycerol hydrolase) (Abhydrolase domain-containing protein 6)
Cleaved into：
GeneID：66082
Gene names (primary )：Abhd6
Gene names (synonym )：
Gene names (ORF )：
Length：336
Mass：38205
Sequence：MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEVLENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
Tissue specificity：Widely expressed with higher expression in small intestine, liver and brown adipose tissue (PubMed:24095738). In brain, expressed postsynaptically in cortical neurons but not detected in microglia (at protein level) (PubMed:20657592). {ECO:0000269|PubMed:20657592, ECO:0000269|PubMed:24095738}.
Induction：Up-regulated in small intestine and liver by high-fat diet. {ECO:0000269|PubMed:24095738}.
Developmental stage：
Protein families：AB hydrolase superfamily