CHTOP_MOUSE Q9CY57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CY57
Recommended name：Chromatin target of PRMT1 protein
EC number：
Alternative names：(Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG)
Cleaved into：
GeneID：66511
Gene names (primary )：Chtop
Gene names (synonym )：Fop
Gene names (ORF )：MNCb-1706
Length：249
Mass：26585
Sequence：MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Tissue specificity：Broadly expressed with highest levels found in thymus, spleen, and lymph nodes. Expressed in an erythroid progenitor cell line derived from fetal liver. {ECO:0000269|PubMed:19254951, ECO:0000269|PubMed:20688955}.
Induction：
Developmental stage：Broadly expressed at 16.5 dpc. {ECO:0000269|PubMed:19858291}.
Protein families：