PBX4_MOUSE Q99NE9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99NE9
Recommended name：Pre-B-cell leukemia transcription factor 4
EC number：
Alternative names：(Homeobox protein PBX4)
Cleaved into：
GeneID：80720
Gene names (primary )：Pbx4
Gene names (synonym )：
Gene names (ORF )：
Length：378
Mass：41961
Sequence：MAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDEAQARKHALNCHRMKSALFSVLCEIKGKTAVSIQFQEEDPPDAQLLRLDNMLLAEGVSRPEKRGRGAAAGSTATPGGCPNDNSIEHSDYRAKLSQIRQIYHSELEKYEQACREFTTHVTNLLREQSRVRPVSCREMEHMVNTIQSKFSAIQRQLKQSTCEAVMTLRSRFLDARRKRRNFSKQATDVLNEYFYSHLSNPYPSEETKEELARKGGITVSQVSNWFGNKRIRYKKNTGKFQEEATMYTGKASTVTKARRPRGQSSCQSTPSPGPCGPLPLTNGSDVVLTLRTLAFLQPPTGGVCLQPLVHSNWQRAAPQPASSPAGESGSFNWDAASN
Tissue specificity：Almost exclusively expressed in testis. {ECO:0000269|PubMed:11335119}.
Induction：
Developmental stage：Expressed in spermatocytes in the pachytene stage of the first meiotic prophase.
Protein families：TALE/PBX homeobox family