COT1_MOUSE   Q60632


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60632

Recommended name:COUP transcription factor 1

EC number:

Alternative names:(COUP-TF1) (COUP transcription factor I) (COUP-TF I) (Nuclear receptor subfamily 2 group F member 1) (V-erbA-related protein 3) (EAR-3)

Cleaved into:

GeneID:13865

Gene names  (primary ):Nr2f1

Gene names  (synonym ):Erbal3 Tfcoup1

Gene names  (ORF ):

Length:422

Mass:46085

Sequence:MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQAGSGAPHTPQTPGQPGAPATPGTQGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS

Tissue specificity:

Induction:

Developmental stage:Expression begins in 8.5-day-old embryos, peaks at 14-15 days and declines before birth.

Protein families:Nuclear hormone receptor family, NR2 subfamily


   💬 WhatsApp