EPYC_MOUSE P70186
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70186
Recommended name：Epiphycan
EC number：
Alternative names：(Dermatan sulfate proteoglycan 3) (Proteoglycan-Lb) (PG-Lb) (Small chondroitin/dermatan sulfate proteoglycan)
Cleaved into：
GeneID：13516
Gene names (primary )：Epyc
Gene names (synonym )：Dspg3 Pglb
Gene names (ORF )：
Length：322
Mass：36763
Sequence：MGMLARVALGLIIIDAVLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNHVENEKVSERLSGNRELLTPGPQLGDNQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKKTTYFYSRFNRIKKINKNDFASLNDLKRIDLTSNLISEIDEDAFRKLPHLQELVLRDNKIKQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYITDNSLDHIPLPLPESLRALHLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNPINLSRTPQAYMCLPRLPIGSFI
Tissue specificity：Confined to the middle zone of embryonic epiphyseal cartilage consisting of flattened chondrocytes and the ossifying region in the limb buds of chick embryos. Has also been detected in testis. {ECO:0000269|PubMed:8836137}.
Induction：
Developmental stage：Expression starts at 12.5 dpc and is restricted to developing cartilage.
Protein families：Small leucine-rich proteoglycan (SLRP) family, SLRP class III subfamily