PRS29_MOUSE Q99MS4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99MS4
Recommended name：Serine protease 29
EC number：EC 3.4.21.-
Alternative names：(Implantation serine proteinase 2) (ISP-2) (Strypsin-2) (Strypsin-related protein) (Tryptase-like proteinase)
Cleaved into：
GeneID：114662
Gene names (primary )：Prss29
Gene names (synonym )：Isp2
Gene names (ORF )：
Length：279
Mass：30986
Sequence：MLIQLCLTLFFLGCSIAGTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
Tissue specificity：Expressed in embryos and placenta. Found in uterus especially in glandular epithelium during zona lysis and implantation. {ECO:0000269|PubMed:11467974, ECO:0000269|PubMed:12112596}.
Induction：Up-regulated in uterine endometrial glands following the initiation of embryo implantation. By progesterone. {ECO:0000269|PubMed:11467974, ECO:0000269|PubMed:15304212, ECO:0000269|PubMed:15349836}.
Developmental stage：Highly expressed from 6.5 dpc plus deciduum. Also expressed, but to a lower extent, in placenta from 11.5 dpc and 13.5 dpc. Not expressed at 8.5 dpc and 11.5 dpc in embryo proper. Expressed at 4.0 dpc in uterus. {ECO:0000269|PubMed:11467974, ECO:0000269|PubMed:12883636, ECO:0000269|PubMed:15349836}.
Protein families：Peptidase S1 family