NDRG1_MOUSE Q62433
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62433
Recommended name：Protein NDRG1
EC number：
Alternative names：(N-myc downstream-regulated gene 1 protein) (Protein Ndr1)
Cleaved into：
GeneID：17988
Gene names (primary )：Ndrg1
Gene names (synonym )：Ndr1 Ndrl Tdd5
Gene names (ORF )：
Length：394
Mass：43009
Sequence：MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQEQDIETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEIHNNVEVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARLNITPNSGATGNNAGPKSMEVSC
Tissue specificity：Widely expressed, with highest levels in kidney followed by brain, pancreas, small intestine, colon and spleen (at protein level). Also detected in heart and preputial gland, and in much smaller quantities in other tissues. Not detected in duodenum and prostate. Highly expressed in Schwann cells. {ECO:0000269|PubMed:15082788, ECO:0000269|PubMed:15461589, ECO:0000269|PubMed:21636852, ECO:0000269|PubMed:9144177}.
Induction：Repressed by testosterone and also to a lesser extent by dihydrotestosterone. Down-regulated by MYCN. {ECO:0000269|PubMed:10381566, ECO:0000269|PubMed:9144177}.
Developmental stage：In early stages of embryo development, expression low when MYCN expression is high. Later, when MYCN levels diminish, levels increase. {ECO:0000269|PubMed:10381566}.
Protein families：NDRG family