QCR9_MOUSE Q8R1I1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1I1
Recommended name:Cytochrome b-c1 complex subunit 9
EC number:
Alternative names:(Complex III subunit 9) (Complex III subunit X) (Cytochrome c1 non-heme 7 kDa protein) (Ubiquinol-cytochrome c reductase complex 7.2 kDa protein)
Cleaved into:
GeneID:66152
Gene names (primary ):Uqcr10
Gene names (synonym ):
Gene names (ORF ):
Length:64
Mass:7446
Sequence:MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE
Tissue specificity:
Induction:
Developmental stage:
Protein families:UQCR10/QCR9 family