SYT16_MOUSE   Q7TN83


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TN83

Recommended name:Synaptotagmin-16

EC number:

Alternative names:(Synaptotagmin 14-like protein) (Synaptotagmin XIV-related protein)

Cleaved into:

GeneID:238266

Gene names  (primary ):Syt16

Gene names  (synonym ):Strep14 Syt14l Syt14r

Gene names  (ORF ):

Length:639

Mass:71255

Sequence:MVLTMASQDVQNFFQPLSSWLSRVYEALQQAGDALSASLVLLSKHDSALSDKPEQDLDAAQIQQTYLEDEEQDHDGSPEEASSLFLEEDHFSLSNSDLQDSVQTASPTLGQQAEDSSSVIPPWPSKIPGAPKPQPVLSSIAEEDHHSERQRCGRQHGSGTLEKVNGRKQVNSFGDDEEPSTSSESDEDVTKQFKISVSRSQSFRSGVSEKGKTTELEQKIKCKRLLCTHQEDSAEGSACEDLDRTSQLSYSEILSYEDRPISILPQSPFESRNVRHHGPCRPEMGMVRSLGRPCADGVLETETAFVSRGFEDSYATHSSSLWSPEEQDGTSLQVPHRLLEPISKCGDLDVIFEYRAVTQKLTVTIVRAQGLPDKDRSGVNSWQVHIVLLPSKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCLSHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDSASSTQSLSHGGVPELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQTCRWHTLLES

Tissue specificity:Highly expressed in heart and testis. Moderately expressed in kidney. {ECO:0000269|PubMed:12801916}.

Induction:

Developmental stage:Weakly expressed at 7 dpc and remains constant from 11 dpc to 17 dpc. {ECO:0000269|PubMed:12801916}.

Protein families:Synaptotagmin family