PIP_HUMAN P12273
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12273
Recommended name：Prolactin-inducible protein
EC number：
Alternative names：(Gross cystic disease fluid protein 15) (GCDFP-15) (Prolactin-induced protein) (Secretory actin-binding protein) (SABP) (gp17)
Cleaved into：
GeneID：5304
Gene names (primary )：PIP
Gene names (synonym )：GCDFP15 GPIP4
Gene names (ORF )：
Length：146
Mass：16572
Sequence：MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Tissue specificity：Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
Induction：By prolactin and androgen; inhibited by estrogen.
Developmental stage：
Protein families：PIP family