RNS12_RAT   Q5GAL8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5GAL8

Recommended name:Probable inactive ribonuclease-like protein 12

EC number:

Alternative names:

Cleaved into:

GeneID:364302

Gene names  (primary ):Rnase12

Gene names  (synonym ):

Gene names  (ORF ):

Length:145

Mass:16,976

Sequence:MILMVIVFLLLLFWENELTEDVVLTSMEHLHVDYPQSAVPLRYCNYMILQRVIREPDYTCRKVHVFIHERPQKINRICTSSKKMTCPNYSEIFCFQSDTKFRMTVCQLTGGSKYPACRYQISPTEGFVLVTCDDLGPVNFQGYVE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp