CRIP2_RAT P36201
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36201
Recommended name：Cysteine-rich protein 2
EC number：
Alternative names：Protein ESP1
Cleaved into：
GeneID：338401
Gene names (primary )：Crip2
Gene names (synonym )：Crp2
Gene names (ORF )：
Length：208
Mass：22,696
Sequence：MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPPTEAPQVTGPIEVPVVRTEERKTSGPPKGPSKASSVTTFTGEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDKDPEGTVQP
Tissue specificity：Expressed more abundantly in liver and kidney of females than that of males. Equally expressed in brain, lung and heart.
Induction：
Developmental stage：
Protein families：