LY65B_RAT   Q6MG53


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6MG53

Recommended name:Lymphocyte antigen 6 complex locus protein G5b

EC number:

Alternative names:

Cleaved into:

GeneID:406867

Gene names  (primary ):Ly6g5b

Gene names  (synonym ):

Gene names  (ORF ):

Length:194

Mass:21,588

Sequence:MRACVLVHVLTMVGFALGKAPVASVRTCHLCFLEDPSIGCISGSEKCTISSSSPCMVITIYQNVKVRFHVRGCGQHHSFRCQENHVIYYSDYWYRVNCCQYDYCNSWSSAQHQSTLPGPPGNHLGVPLSESQIKQFYQALHLPLFQPDLHTHKVSEGPDSLILPPGLGLSIADLRKIYLFLNSSGLLVLPQARP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp