CRGN_RAT   D3ZEG1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZEG1

Recommended name:Gamma-crystallin N Curated

EC number:

Alternative names:

Cleaved into:

GeneID:296730

Gene names  (primary ):Crygn

Gene names  (synonym ):

Gene names  (ORF ):

Length:183

Mass:21,446

Sequence:MAQRSGKITLYEGKHFTGRKLEVFGDCDNFQDRGFMNRVNSIRVESGAWVCFDHPDFRGQQFILEHGDYPEFFRWNGHNDHMGSCRPVGMHGEHFRIDIFEGCNFTGQCLEFVEDCPFLQSRGWAKSCVNAIKVYGDGAWVLYEEPNYRGRMYVVERGDFRSFSDWEAHSARVQSLRRVLNFF

Tissue specificity:Detected in the auditory hindbrain where it is highly expressed in the medial nucleus of the trapezoid body, but also present in other nuclei of the superior olivary complex. 1

Induction:

Developmental stage:

Protein families:beta/gamma-crystallin family


   💬 WhatsApp