EMP1_RAT P54848
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P54848
Recommended name：Epithelial membrane protein 1
EC number：
Alternative names：Tumor-associated membrane protein
Cleaved into：
GeneID：25314
Gene names (primary )：Emp1
Gene names (synonym )：
Gene names (ORF )：
Length：160
Mass：17,826
Sequence：MLVLLAGLFVVHIATAIMLFVSTIANVWMVADGIDSSIGLWKNCTSGSCDGSLSYGNDDAIKAVQAFMILSIIFSIISLVVFVFQLFTMEKGNRFFLSGSTMLVCWLCILIGVSIYTHHYAHSEGNFFPSSHQGYCFILTWICFCFSFIIGILYMVLRKK
Tissue specificity：Most prominently found in the gastrointestinal tract, skin, lung, and brain but not in liver.
Induction：
Developmental stage：
Protein families：