NXPH3_RAT   Q9Z2N5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2N5

Recommended name:Neurexophilin-3

EC number:

Alternative names:

Cleaved into:

GeneID:59315

Gene names  (primary ):Nxph3

Gene names  (synonym ):Nph3

Gene names  (ORF ):

Length:252

Mass:28,225

Sequence:MQLTRCCFVFLVQGSLYLVICGQEDGPPGSEDPEHDDHEGQPRPRVPRKRGHISPKSRPLANSTLLGLLAPPGEVWGILGQPPNRPKQSPLPSTKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFRHNATGQGNISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKIVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSG

Tissue specificity:Brain. Detected in several other tissues.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp