RISC_RAT Q920A6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920A6
Recommended name：Retinoid-inducible serine carboxypeptidase
EC number：EC:3.4.16.-
Alternative names：Serine carboxypeptidase 1
Cleaved into：
GeneID：114861
Gene names (primary )：Scpep1
Gene names (synonym )：Risc
Gene names (ORF )：
Length：452
Mass：51,175
Sequence：MELSRRICLVRLWLLLLSFLLGFSAGSALNWREQEGKEVWDYVTVREDARMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTRLKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISLELHKAIQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSVSLLDNKGLAEVSDIAEQVLNAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSTPDTSMESSLEFFRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPDDVSWGAQSSSVFISMEEDFMKPVIDIVDTLLELGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSRFNQLKWKALYTNPKSSETSAFVKSYENLAFYWILKAGHMVPADQGDMALKMMRLVTQQE
Tissue specificity：Highly expressed in aorta, bladder, and kidney with much lower levels in all other tissues analyzed. Expression in kidney is restricted to proximal convoluted tubules.
Induction：
Developmental stage：By retinoic acid.
Protein families：