DUS11_RAT   Q4KM79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KM79

Recommended name:RNA/RNP complex-1-interacting phosphatase

EC number:EC:3.1.3.-

Alternative names:Dual specificity protein phosphatase 11 Phosphatase that interacts with RNA/RNP complex 1

Cleaved into:

GeneID:297412

Gene names  (primary ):Dusp11

Gene names  (synonym ):Pir1

Gene names  (ORF ):

Length:326

Mass:38,068

Sequence:MNQWHYGRYSRGRDFTARAPPKKKGKNQIPERWKDYLPVGQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPKTISYIKILTVGHQVPDSGTIFQFKSAVKEFLKRNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMRPDDAIELFNRCRGHCIERQNYIENLQKRRVRKNQNASASRSGGLEDSAHLTEQVHTTNKPVNKGPKKSRRGGHLESSQHVQTQSSAYSFRKWSQNQSVYQRGFVPPPGPAGEDYSQRRFFWSMRPNGSQATHHKKWIAASYQRPFYPASWEWNV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp