GP156_RAT Q8K451
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K451
Recommended name：Probable G-protein coupled receptor 156
EC number：
Alternative names：
Cleaved into：
GeneID：260430
Gene names (primary )：Gpr156
Gene names (synonym )：Gababl
Gene names (ORF )：
Length：792
Mass：86,426
Sequence：MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITDSQHGSADISPLSPALLGVIWTFLSCGLLLVLFFLAFTIRCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDALVGSSVEALIQTRLSLLCIGTTLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILLVTWVLTDPIQCLQILGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGAYLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCTTTVNCCVFLPQLRQRKAFEGENQTIRHMAKYFSTPSKTFRSKFDEDQSCHLRDEXSCMERLLTEKNAVIESLQEQVSNAKEKLVKLMSAECALDSPEWAVPAAASAGGPAECXATSEKESGAAAEDSLPASAASQHMQGPGASRRDXSPSPDQKYDMPLKQFCDHLDMGCSQKPKAEQSEGPERGNQEPMAPGQSLMTDGVACEPHRPRQNSEVLPERLPRVSSVVREKLQEVLQELDLGTEAPLSPLPCPQQPWKSNTSGSPQKLSPSKLGFSPYVVRRRRAAQRARSRIPGSVGLKMGHQANNTVSGSQNGLIVQNRDSPRLDHHNARSKEPRSSSVKPSPISAPHQRRGSLEGSKQCETEPQEARGYSVAFPRQPSASAPAQSSTAPCLSSXPALPRQRQPLPLLSPGCPSLSSGCYNLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQTSGLASWEKLLARSKPVVNFKDDLKPTLV
Tissue specificity：Widely expressed throughout the brain and is particularly dense in the olfactory tubercles, islands of Calleja, nucleus accumbens, piriform cortex and all fields of the hippocampus. 1
Induction：
Developmental stage：
Protein families：