UCMA_RAT B9TQX4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B9TQX4
Recommended name：Unique cartilage matrix-associated protein By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：291312
Gene names (primary )：Ucma By Similarity
Gene names (synonym )：Grp Imported
Gene names (ORF )：
Length：138
Mass：16,574
Sequence：MSWRQVILLSSLSALVLLCMLQEGTSASVGSRQAAGEEVQEGMKQKIFMQESDASNFLKRRGKRSPKSRDEVTAENRQKLRDDELRREYYEEQRNEFENFVEEQRDEQEERTREAVEQWRQWHYDGLYPSYLYNRQNI
Tissue specificity：Detected in immature, proliferating, mature, columnar and hypertrophic chondrocytes from ribs, tail, vertebra and femur. 1
Induction：
Developmental stage：
Protein families：