RPA12_RAT   Q6MFY5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6MFY5

Recommended name:DNA-directed RNA polymerase I subunit RPA12 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:361784

Gene names  (primary ):Polr1h By Similarity

Gene names  (synonym ):Znrd1 Imported

Gene names  (ORF ):

Length:123

Mass:13,586

Sequence:MELARPCSNFQSDLDFCPDCGSVLPLPGVQDTVICPRCGFSIDVRDFGGKVVKTSVVFNKLGTVIPMSVDEGPESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEKEDS

Tissue specificity:

Induction:

Developmental stage:

Protein families:archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family


   💬 WhatsApp