S2540_RAT   Q498U3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q498U3

Recommended name:Mitochondrial glutathione transporter SLC25A40 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Slc25a40

Gene names  (synonym ):

Gene names  (ORF ):

Length:337

Mass:38,061

Sequence:MEPETEGPPPTIQVTPLQQMMASCAGAVVTSLMVTPLDVVKIRLQAQNNPFPKGKCFLYSNGLMDHICICEEESKKAWYKKPGNFHGTLDAFLKIVRNEGIKSLWSGLPPTLVMAVPATVIYFTCYEQLSTFLKTKLGENETRIPIVAGIVARFGAVTMISPLELIRTKMQSKTFSYKELYQIVSMKVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLRRWLCEKSDLYESTFMINFTAGALSGSFAAVATLPFDVVKTQKQTQLWTHEYCKFPEPLDMSTWSIMKNIVADRGFSGLFTGLIPRLVKIVPACAIMISSYELGKGFFQQQNVESR

Tissue specificity:Widely expressed at low level. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp