NTM1B_RAT   D3ZVR1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZVR1

Recommended name:N-terminal Xaa-Pro-Lys N-methyltransferase 2

EC number:EC:2.1.1.299

Alternative names:Alpha N-terminal protein methyltransferase 1B Methyltransferase-like protein 11B X-Pro-Lys N-terminal protein methyltransferase 1B (NTM1B)

Cleaved into:

GeneID:289167

Gene names  (primary ):Ntmt2

Gene names  (synonym ):Mettl11b Imported

Gene names  (ORF ):

Length:283

Mass:32,312

Sequence:MAHLGAHFAFRSRWQKTDDELCRHSMSFILHKAIRNDFFQSYLYLLEKIPLVKLYALTSQVIDGEMQFYARAKLFYQEVPATEEGMMGNFIELSNPDIQASREFLRKFVGGPGRAGTGCALDCGSGIGRVSKHVLLPVFSSVELVDMMESFLLEAQSYLQVNENKVESYHCYSLQEFTPHLGRYDVIWIQWVSGYLTDKDLLAFLSRCRDGLKENGVIILKDNVAREGCIFDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQEGFPEQCVPVWMFALHSDRHS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp