PR3C1_RAT   Q9QUL0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUL0

Recommended name:Prolactin-3C1

EC number:

Alternative names:

Cleaved into:

GeneID:58937

Gene names  (primary ):Prl3c1

Gene names  (synonym ):Prlpi, Prlpj

Gene names  (ORF ):

Length:211

Mass:24,575

Sequence:MQLSLTQARTWKGLLLLVSCMILWISVTPTPYDQMSNEELYDNLLSCSHRTHVVARKMYKILDLNVAERRCFKNKRNNTCHTTSTHTAKTNEDLLKVIISVSNAWIYPLKMLIPAVLTHLGSYDGMMARAIELNYGNQKILEGAKFLLSRIQPGIEENDYPVWSSLKELRSSNKSIHLFAFCKFFYCLRKDTKKIKDYLQILRPNIIKNKW

Tissue specificity:Expressed exclusively in decidual tissue. 2 s

Induction:

Developmental stage:Expression limited to early pregnancy with abundant expression on day 7, slightly declining expression on day 9, and no detectable expression by day 11. 1

Protein families:


   💬 WhatsApp