P2Y13_RAT Q6GUG4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6GUG4
Recommended name：P2Y purinoceptor 13
EC number：
Alternative names：
Cleaved into：
GeneID：310444
Gene names (primary )：P2ry13
Gene names (synonym )：
Gene names (ORF )：
Length：336
Mass：38,823
Sequence：MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNSTFIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETMYVGIMMLGLIAFDRFLKIVVPFRKTFVKKTAFAKIVSISIWLLMFLISLPNMILNKEATASTVKKCASLKSPLGLLWHQVVSHTCQFIFWTVFILMLLFYTVIAKKVYDSYRKFKSRDSKHKRLEAKVFIVMAVFFVCFAPFHFVRVPYTHSQTTNKTDCRLENQLFLAKESTLFLATTNICMDPLIYIILCKKFTRKVPCMRWRTKTAASSDEHHSSQTDNITLS
Tissue specificity：Highest levels in spleen, liver brain and kidney. Lower but significant level are also detected in intestine, stomach, skeletal muscle, testis, heart and lung. 1
Induction：
Developmental stage：
Protein families：