PROF4_RAT Q5IRJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5IRJ7
Recommended name：Profilin-4
EC number：
Alternative names：
Cleaved into：
GeneID：494222
Gene names (primary )：Pfn4
Gene names (synonym )：
Gene names (ORF )：
Length：129
Mass：14,421
Sequence：MSHLQNLLLDTLLGTKHVDGAALIKLQEKTLCVTSPGFSVMPCDVRTLLNGFAKNPLLTRREGLYFREKDYKCVRADDCSLYAKKENTGVVVVKTHMYLLVATYTAGMYPSVCVEATEKLGEYLRKKGN
Tissue specificity：Expressed in testis, in seminiferous tubules (at protein level) (PubMed:15591451, PubMed:19419568). Expressed in spermatocytes and spermatids, but not in spermatogonium (PubMed:15591451). 2 s
Induction：
Developmental stage：Expression in seminiferous tubules overlaps with the onset of meiosis, starting from spermatocytes of the late pachytene stages and proceeding throughout meiosis to the round spermatids. Detected in nearly all stages of spermiogenesis (at protein level). 2 s
Protein families：