SEP15_RAT Q923V8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923V8
Recommended name:Selenoprotein F By Similarity
EC number:
Alternative names:
Cleaved into:
GeneID:113922
Gene names (primary ):Selenof By Similarity
Gene names (synonym ):Sep15 Imported
Gene names (ORF ):
Length:162
Mass:17,822
Sequence:MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI
Tissue specificity:Highest levels in prostate, lower levels in brain, lung, thyroid gland, and large intestine. 1
Induction:
Developmental stage:
Protein families: