ABHDA_RAT Q5I0K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5I0K5
Recommended name：Palmitoyl-protein thioesterase ABHD10, mitochondrial By Similarity
EC number：EC:3.1.2.22
Alternative names：Acyl-protein thioesterase ABHD10 By Similarity Alpha/beta hydrolase domain-containing protein 10 By Similarity (Abhydrolase domain-containing protein 10 By Similarity) Mycophenolic acid acyl-glucuronide esterase, mitochondrial By Similarity (EC:3.1.1.93 By Similarity) . EC:3.1.1.93 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：303953
Gene names (primary )：Abhd10
Gene names (synonym )：
Gene names (ORF )：
Length：297
Mass：33,153
Sequence：MAAWVPCRKWGWAAVSFGRHRGLIASLARKPPWAWWLSACRQKTTLSFLKRPELPSLAYKRLKGKNPGIIFIPGYLSNMNGKKAVAIEEFCKSIGHAFIRFDYSGVGSSDGNLAECSVGKWRKDVLSILDDIAEGPQILVGSSLGGWLMLHAAIARPEKVIALIGIASATDGVVTQFHSLPVEMQKEIEMKGEWSLPSKYNKEGYYSIPYSFIKEAAHHCLLHSPIPVTCPVRLLHGMKDEIVPWHRSLQVADRVVSPDVDVILRKHSDHRMKETADIHLLICTIDDLIDKLSTVTH
Tissue specificity：Expressed in epididymal sperm but not in testicular sperm (at protein level). 1
Induction：
Developmental stage：
Protein families：