MAGT1_RAT O35777
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35777
Recommended name：Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1
EC number：
Alternative names：Implantation-associated protein (IAP) Magnesium transporter protein 1 Curated (MagT1)
Cleaved into：
GeneID：116967
Gene names (primary )：Magt1
Gene names (synonym )：Iag2
Gene names (ORF )：
Length：335
Mass：37,993
Sequence：MASPRWLWCVCATAAVTLLLVSKVPSASAQRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPKRADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
Tissue specificity：
Induction：
Developmental stage：
Protein families：