S52A2_RAT B5MEV3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B5MEV3
Recommended name：Solute carrier family 52, riboflavin transporter, member 2
EC number：
Alternative names：
Cleaved into：
GeneID：362942
Gene names (primary )：Slc52a2
Gene names (synonym )：Gpr172a, Gpr172b, Rft1
Gene names (ORF )：
Length：450
Mass：46,956
Sequence：MAAPPLGRLVLTHLLVALFGMGSWIAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRRLAPGKSERIPIQVVQGLSIVGTGLLAPLWSNMALVAGQLHSVAFLTLAFVLALSCCASNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALAQGVGRLECLHVPANGTTGPPIKVSPINFPERFSAGTFFWVLTALLGTSAAAFQGLLLLLPSPPPEATMGTGLRVETPGTEEEEEEEEASPLQEPPGQVASIVSSPDPKAHRLFSSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSSANPLACFLAMAVLCRSLAGLYGLCLLGMFFGTYLMTLAVLSPCPPLVGTSAGVVLVVLSWVLCAGVFSYIKVATSSMLHSGGRPALLAAGVAIQVGSLLGAIAMFPPTSVYPVFRSGEDCVDQCGP
Tissue specificity：Highly expressed in the placenta and small intestine, moderately in the kidney, colon, lung, prostate, uterus, and thymus, and weakly in all other tissues. 1
Induction：
Developmental stage：
Protein families：