ONCM_RAT   Q65Z15


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q65Z15

Recommended name:Oncostatin-M

EC number:

Alternative names:

Cleaved into:

GeneID:289747

Gene names  (primary ):Osm

Gene names  (synonym ):

Gene names  (ORF ):

Length:239

Mass:27,106

Sequence:MRAQPPPRTLLSLALALLFLSMSWAKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR

Tissue specificity:Widely expressed. Expressed at higher levels in liver, skin and spleen. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp