TRUB2_RAT   Q5XFW2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XFW2

Recommended name:Pseudouridylate synthase TRUB2, mitochondrial Curated

EC number:EC:5.4.99.-

Alternative names:TruB pseudouridine synthase homolog 2 By Similarity tRNA pseudouridine 55 synthase TRUB2 Curated (Psi55 synthase TRUB2 Curated) (EC:5.4.99.25 By Similarity) . EC:5.4.99.25 (UniProtKB | ENZYME | Rhea) By Similarity

Cleaved into:

GeneID:366012

Gene names  (primary ):Trub2

Gene names  (synonym ):

Gene names  (ORF ):

Length:323

Mass:36,109

Sequence:MGSSGLARLQGLFAVYKPPGLKWLHVRETVELQLLKGLNAQQPSAPEQHVRFLLGPVEGSEEKKLTLTATSVPSLTTHRLVRGPAFRNLKIGVGHRLDVQASGVLVLAVGHGRSLLTDMYDAHLTKDYTVRGLLGKATDNFCEDGQLIEKTTYDHVTRERLDRILAMIQGSHQKALVMYSNLDLKSQEAYERAVQGVIRPMNKSPMLIAGIRCLHFAPPEFLLEVQCMHETQQQLRRLVHEIGLELKTTAVCMQVRRTRDGFFGLDDALLRTQWDLHSIQDAIQTAAPRVARELRKNLSLMSGHQQQLPSAGQPWASRVQAPL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp