DAD1_RAT   P61805


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61805

Recommended name:Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Curated

EC number:

Alternative names:Defender against cell death 1 (DAD-1)

Cleaved into:

GeneID:192275

Gene names  (primary ):Dad1

Gene names  (synonym ):

Gene names  (ORF ):

Length:113

Mass:12,497

Sequence:MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp