CYAC3_RAT   Q5U2W7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5U2W7

Recommended name:Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3 Curated

EC number:EC:7.2.1.3

Alternative names:Cytochrome b ascorbate-dependent protein 3 Imported Cytochrome b561 family member A3 Imported Lysosomal cytochrome b By Similarity (LCytb By Similarity)

Cleaved into:

GeneID:361729

Gene names  (primary ):Cyb561a3

Gene names  (synonym ):Cybasc3 Imported

Gene names  (ORF ):

Length:256

Mass:28,650

Sequence:MASGWFYMSCMVLGSLGSMCILFTTYWMQYWRGGFAWDGTVLMFNWHPVLMVSGMVVLYGAASLVYRLPASWVGPKLPWKVLHAALHLLAFTVTVVGLTAVFGFHNHSKITHLYSLHSWLGITTVALFACQWFLGFAVFLLPWASQWLRSLLKPVHVFFGACILSLSIASVISGINEKLFFVLKNATRPYSSLPGEAVFANSTGILVVSFGLLVLYILLASSWRRPDPGALTDRQVWLLVSHYRWDKAKKACFAPC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp