ZFAN6_RAT   Q6DGF4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6DGF4

Recommended name:AN1-type zinc finger protein 6

EC number:

Alternative names:

Cleaved into:

GeneID:293067

Gene names  (primary ):Zfand6

Gene names  (synonym ):Za20d3

Gene names  (ORF ):

Length:223

Mass:24,001

Sequence:MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp