PNPO_RAT   O88794


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88794

Recommended name:Pyridoxine-5'-phosphate oxidase

EC number:EC:1.4.3.5

Alternative names:Pyridoxamine-phosphate oxidase

Cleaved into:

GeneID:64533

Gene names  (primary ):Pnpo

Gene names  (synonym ):

Gene names  (ORF ):

Length:261

Mass:30,184

Sequence:MTCGLLSVTVTFRRPAKWPGYFRHLCCRGAVMDLGPMRKSYRGDREAFEEAHLTSLDPMKQFASWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNYESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPKSSQIGAVVSRQSSVIPDREYLRKKNEELGQLYREQEVPKPEYWGGYILYPQVMEFWQGQTNRLHDRIVFRRGLATGDSPLGPMTHHGEEDWVYERLAP

Tissue specificity:Detected in adult liver. 1

Induction:

Developmental stage:Detected at low levels in fetal brain, and at high levels in adult brain. 1

Protein families:


   💬 WhatsApp