ENTP8_RAT Q5DRK1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5DRK1
Recommended name：Ectonucleoside triphosphate diphosphohydrolase 8
EC number：EC:3.6.1.5
Alternative names：E-NTPDase 8; NTPDase 8; NTPDase8
Cleaved into：
GeneID：613267
Gene names (primary )：Entpd8
Gene names (synonym )：
Gene names (ORF )：
Length：494
Mass：54,330
Sequence：MRLSWKERVFMVLLGVAAASGLTMLILILVKATNVLLPADTKFGILFDAGSSHTSLFVYQWPANKEKDTGVVSQALACQVEGPGISSYTSDPTQAGESLKSCLQEALALIPQTQHPVTPAFLGATAGMRLLSQKNSSQAQDILAAVSQTLSRAPVDFWGARILAGQDEGAFGWITVNYVLGMLLKYSSGQWILPEDGTLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILRRLLAELVQSSQVARVRHPCYHSGYQATLSLASLYDSPCVHTPDSLNYTQNLTVEGIGNPGNCVAALRGLFNFSSCKGQEDCAFNGVYQPPVHGQFYAFSNFYYTFQFLNLTSRQPLNIVNDTIWKFCQKPWRLVEDSYPGQERWLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGGTDIGWTLGFMLNLTGMIPAEALTQWRAQSYSIWIAGVVFAVLTLVAILGAAAVQLFWTQD
Tissue specificity：Present in liver, and at lower level in jejunum and kidney. Limited to the canalicular domain of hepatocytes (at protein level). 1
Induction：
Developmental stage：
Protein families：GDA1/CD39 NTPase family