LST8_RAT Q9Z2K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2K5
Recommended name：Target of rapamycin complex subunit LST8 Curated
EC number：
Alternative names：G protein beta subunit-like (Protein GbetaL) Mammalian lethal with SEC13 protein 8 (mLST8)
Cleaved into：
GeneID：64226
Gene names (primary )：Mlst8
Gene names (synonym )：Gbl, Lst8
Gene names (ORF )：
Length：326
Mass：35,943
Sequence：MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAATGYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGTSHIWDLKTDHNEQLIPEPEFSITSAHIDPDASYMAAVNSAGNCFVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
Tissue specificity：Expressed at highest levels in the brain and testis, followed by lung, heart, kidney, skeletal muscle, spleen and liver. Also expressed in epididymal, abdominal and brown fat, small intestine and pancreas. 1
Induction：
Developmental stage：By insulin in adipocytes (at protein level). 1
Protein families：