NDK7_RAT Q9QXL7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXL7
Recommended name：Nucleoside diphosphate kinase homolog 7
EC number：
Alternative names：3'-5' exonuclease NME7 (EC:3.1.-.- By Similarity) . EC:3.1.-.- (UniProtKB | ENZYME | Rhea) By Similarity Protein kinase NME7 (EC:2.7.-.- By Similarity) . EC:2.7.-.- (UniProtKB | ENZYME | Rhea) By Similarity nm23-H7
Cleaved into：
GeneID：171566
Gene names (primary )：Nme7
Gene names (synonym )：
Gene names (ORF )：
Length：395
Mass：44,510
Sequence：MKAGQQGRSCGLISPYLAPKNQSERFAFIAEWYDPNASLLRRYELLYYPVDGSVEMHDVKNRRTFLKRTKYEDLRVEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLSRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGIARSEAPGSVRALFGTDGIRNAAHGSDTFESAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFEISAIQMFNMDRANVEEFYEVYKGVVSEYNDMVTELYSGPCVAIEIQQSNPTKTFREFCGPSDPEIARHLRPETLRANFGKTKVQNAVHCTDLPEDGLLEVQYFFKILDN
Tissue specificity：Widely expressed (PubMed:33916973). Expressed in the flagellum of epididymal sperm but not in testicular sperm (at protein level) 2 s
Induction：
Developmental stage：
Protein families：NDK family