BAALC_RAT Q920K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920K5
Recommended name：Brain and acute leukemia cytoplasmic protein
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Baalc
Gene names (synonym )：
Gene names (ORF )：
Length：145
Mass：15,475
Sequence：MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDALPSAAATDSGPEAGGLHAGVLEDGPSSNGVLRPAAPGGIANPEKKMNCGTQCPNSQSLSSGPLTQKQNGLWTTEAKRDAKRMSAREVAISVTENIRQMDRSKRVTKNCIN
Tissue specificity：Predominantly expressed in the brain (at protein level) (PubMed:11707601, PubMed:15659234). Within the brain, found in most of forebrain structures, including the cerebral cortex, hippocampal formation, olfactory bulb, anterior olfactory nuclei, piriform cortex, tenia tecta and amygdaloid nuclei. Not detected in glial cells (PubMed:15659234). 2 s
Induction：
Developmental stage：In the developing forebrain, barely detected at postnatal day 1. Expression increases from the first week after birth. High levels are reached during 2 and 3 weeks after birth and slightly decrease at 6 weeks after birth. This expression pattern parallels synaptogenesis. 1
Protein families：