S6A15_RAT Q08469
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08469
Recommended name：Sodium-dependent neutral amino acid transporter B(0)AT2
EC number：
Alternative names：
Cleaved into：
GeneID：282712
Gene names (primary )：Slc6a15
Gene names (synonym )：Ntt73
Gene names (ORF )：
Length：729
Mass：81,596
Sequence：MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEDVSKKSELIVDVQEEKDTDAEDGSEVDDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQCPLVKNASHTYIEPECEKSSATTYYWYREALAISSSISESGGLNWKMTGCLLAAWVMVCLAMIKGIQSSGKIMYFSSLFPYVVLICFLIRSLLLNGSIDGIRHMFTPKLEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANIVNEKCISQNSEMILKLLKTGNVSWDVIPRHINLSAVTAEDYHVVYDIIQKVKEEEFAVLHLKACQIEDELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIEGIITPVVDTFKVRKEILTVICCLLAFCIGLMFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDKFLEDLTDMLGFAPSKYYYYMWKYISPLMLVTLLIASIVNMGLSPPGYNAWIKEKASEEFLSYPMWGMVVCFSLMVLAILPVPVVFVIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLDGDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADMPDMPESDL
Tissue specificity：Widely distributed in the central nervous system, including the olfactory bulb, the hypothalamus, the cerebral cortex, the hippocampus, and the cerebellum. In addition, intense expression is found in the motor nuclei including the oculomotor nucleus, abducens nucleus, trigeminal motor nucleus, facial nucleus, hypoglossal nucleus and ventral horn of spinal cord. Intense hybridization signals are also observed in the nuclei containing monoaminergic neurons, such as locus coeruleus, the substantia nigra pars compacta, the ventral tegmental area, the dorsal raphe nucleus and the median raphe nucleus. 1
Induction：
Developmental stage：
Protein families：