HBEGF_RAT   Q06175


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q06175

Recommended name:Proheparin-binding EGF-like growth factor

EC number:

Alternative names:

Cleaved into:

GeneID:25433

Gene names  (primary ):Hbegf

Gene names  (synonym ):Dtr, Hegfl

Gene names  (ORF ):

Length:208

Mass:22,843

Sequence:MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH

Tissue specificity:Most abundant in skeletal muscle, lung, spleen brain and heart. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp