PRRP_RAT   P81278


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P81278

Recommended name:Prolactin-releasing peptide

EC number:

Alternative names:Prolactin-releasing hormone

Cleaved into:

GeneID:

Gene names  (primary ):Prlh

Gene names  (synonym ):Prh

Gene names  (ORF ):

Length:83

Mass:9,215

Sequence:MALKTWLLCLLLLSLVLPGASSRAHQHSMETRTPDINPAWYTGRGIRPVGRFGRRRATPRDVTGLGQLSCLPLDGRTKFSQRG

Tissue specificity:Widely expressed, with highest levels in medulla oblongata and hypothalamus. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp