CHP1_RAT P61023
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61023
Recommended name：Calcineurin B homologous protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：64152
Gene names (primary )：Chp1
Gene names (synonym )：Chp
Gene names (ORF )：
Length：195
Mass：22,432
Sequence：MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Tissue specificity：Expressed in liver and kidney (at protein level). Ubiquitously expressed. Expressed in the brain, lung, testes, kidney, spleen and heart. 3 s
Induction：
Developmental stage：
Protein families：