SMS_RAT P60042
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60042
Recommended name：Somatostatin
EC number：
Alternative names：Antrin Somatostatin-28 Somatostatin-14 Neuronostatin 2 Publications (NST 1 Publication)
Cleaved into：
GeneID：24797
Gene names (primary )：Sst
Gene names (synonym )：Smst
Gene names (ORF )：
Length：116
Mass：12,746
Sequence：MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Tissue specificity：Somatostatin is detected in neurons throughout the brain, including in the lateral septum, nucleus accumbens, amygdaloid complex, hypothalamic periventricular nucleus, hippocampus, cortex, cerebellum and several brainstem nuclei (at protein level) (PubMed:20056135). Neuronostatin is widely expressed with highest levels in pleen and pancreas, followed by cerebrum and hypothalamus (at protein level) (PubMed:18753129, PubMed:26561648). Neuronostatin plasma levels are higher in fasted, as compared to fed animals (PubMed:26561648). In the brain, neuronostatin is mainly present in the hypothalamic periventricular nucleus and median eminence (at protein level) (PubMed:20056135). 3 s
Induction：
Developmental stage：
Protein families：