NH2L1_RAT P55770
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55770
Recommended name:NHP2-like protein 1
EC number:
Alternative names:NHP2-like protein 1, N-terminally processed
Cleaved into:
GeneID:300092
Gene names (primary ):Snu13
Gene names (synonym ):Nhp2l1 Imported
Gene names (ORF ):
Length:128
Mass:14,174
Sequence:MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Tissue specificity:
Induction:
Developmental stage:
Protein families: