CMA1_RAT P50339
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50339
Recommended name：Chymase
EC number：EC:3.4.21.39
Alternative names：Alpha-chymase Mast cell protease 3 (rMCP-3) Mast cell protease 5 (rMCP-5) Mast cell protease III (rMCP-III)
Cleaved into：
GeneID：25627
Gene names (primary )：Cma1
Gene names (synonym )：Mcpt3
Gene names (ORF )：
Length：247
Mass：27,569
Sequence：MNLHALCLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQSCKHFTSFQHKSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHPNAKPPAVFTRISHYRPWINKILREN
Tissue specificity：Mast cells.
Induction：
Developmental stage：
Protein families：